Hydraulic Orbit Motor BMH: *Advanced manufacturing devices for the Gerolor gear set, which use low pressure of start-up,provide smooth, reliable operation and high efficiency. *Shaft seal can bear high pressure of back and the motor can be used in parallel or series. *Special ...
Shijiazhuang Hanjiu Technology Co.,Ltd [Tools] [Hydraulic Tools] [2017-10-16 17:09:20 ]
Hydraulic Orbit Motor BMP BMP series motor are small volume, economical type, which is designed with shaft distribution flow, which adapt the Gerotor gear set design and provide compact volume, high power and low weigth. Characteristic Features: * Advanced manufacturing devices ...
Shijiazhuang Hanjiu Technology Co.,Ltd [Tools] [Hydraulic Tools] [2017-10-16 17:02:33 ]
Plastic Filter Fan Guard 60mm Place of Origin:China (Mainland) port:shenzhen Brand Name:greatcooler Packaging & Delivery Packaging Details:standard package Delivery Detail:Shipped in 15-25 days after payment. If you have any needs , pls feel free contact me . ...
Greatcooler Electronic Technology Co.,LTD [Consumer Electronics] [Other Consumer Electronics] [2017-10-16 16:41:03 ]
120mm fan metal guard Place of Origin:China (Mainland) port:shenzhen Brand Name:greatcooler MOQ: 500PCS Packaging & Delivery Packaging Details:standard package Delivery Detail:Shipped in 15-25 days after payment . If you have any needs ， pls feel free contact me . ...
Greatcooler Electronic Technology Co.,LTD [Consumer Electronics] [Other Consumer Electronics] [2017-10-16 16:10:45 ]
Custom Ntag213 / 215 White Card, Game Card Design,14443A Agreement White Standard Original NTAG215 Chip NFC Electronic Label NFC Sticker Label Aikeyi Technology WeChat:aky_01,Skype:13423626252,QQ:2880179620,WhatsApp:15011978320) Diameter:25mm,or customized Chip Model: NTAG 215 ...
Guangzhou AIKEYI Smart Card Technology Co.,Ltd. [Packaging & Printing] [Printing Services] [2017-10-16 15:42:14 ]
H3 electronic label international standard white card Aikeyi Technology WeChat:aky_01,Skype:13423626252,QQ:2880179620,WhatsApp:15011978320) About H3 electronic tags project description Remarks Manufacturer / chip Alien/Higgs3 Base material PET Antenna process mode Aluminum ...
Guangzhou AIKEYI Smart Card Technology Co.,Ltd. [Packaging & Printing] [Printing Services] [2017-10-16 15:40:55 ]
Features: 1: HD: 960P(1280*960), 1.3 MP, H.264. 2: Night Vision: Adopt new starlight level sensor, with shimmer night visioin is full color, IR distance 20M. 3: Lens: 4mm, F16 Starlight level Lens with better ngith vision. 4: microSD Card: Supports upto 64GB microSD card for ...
Shenzhen Sricctv Technology Co.Ltd. [Security & Protection] [CCTV Camera] [2017-10-16 14:26:22 ]
Creative Peptides offers HLA-A_24_02 HBV pol tetramer-KYTSFPWLL-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www.creative-peptides.com/product/hla-a-hbv-pol-tetramer-kytsfpwll-apc-labeled-item-cpm-1-0033-33873.html for more ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:25:35 ]
Creative Peptides offers HLA-A_01_01 CMV pp50 tetramer-VTEHDTLLY-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www.creative-peptides.com/product/hla-a-cmv-pp50-tetramer-vtehdtlly-apc-labeled-item-cpm-1-0035-33875.html for more ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:23:37 ]
Creative Peptides offers HLA-A_24_02 hTERT tetramer-VYGFVRACL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www.creative-peptides.com/product/hla-a-htert-tetramer-vygfvracl-pe-labeled-item-cpm-1-0036-33876.html for more ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:23:10 ]
Creative Peptides offers HLA-E_01_03 HLA-A leader3-11 tetramer-VMAPRTLVL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www.creative-peptides.com/product/hla-e-hla-a-leader3-tetramer-vmaprtlvl-pe-labeled-item-cpm-1-0037-33877.html ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:21:07 ]
Creative Peptides offers H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www.creative-peptides.com/product/h-2ld-hbsag-tetramer-ipqsldswwtsl-pe-labeled-item-cpm-1-0039-33879.html for more ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:18:15 ]
Creative Peptides offers HLA-A_11_01 CMV pp65 tetramer-ATVQGQNLK-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www.creative-peptides.com/product/hla-a-cmv-pp65-tetramer-atvqgqnlk-pe-labeled-item-cpm-1-0040-33880.html for more ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:16:28 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications: Ser-21 = ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:13:43 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M.W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:12:09 ]
Product Name Filing cabinet Brand Feng Long Model FC-N3-3 Dimension H1031mm*W452mm*D620mm, per customer`s requirement Packing Volume 0.069CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furniture Port ...
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [Furniture] [Metal Furniture] [2017-10-16 14:11:15 ]
Sequence KRMKVAKSAQ M.W/Mr. 1146.42 Molecular Formula C48H91N17O13S Storage -20°C Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:10:18 ]
4mm fan metal guard Place of Origin:China (Mainland) port:shenzhen Brand Name:greatcooler Packaging & Delivery Packaging Details:standard package Delivery Detail:Shipped in 15-25 days after payment. If you have any needs , pls feel free contact me . ...
Greatcooler Electronic Technology Co.,LTD [Consumer Electronics] [Other Consumer Electronics] [2017-10-16 14:09:56 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We ...
Creative Peptides [Chemicals] [Pharmaceutical Chemicals] [2017-10-16 14:08:21 ]
Item Specifications Product Name Steel cabinet Brand Feng Long Model SC-L1 Dimension H900mm*W400mm*D900mm, per customer`s requirement Packing Volume 0.093CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office ...
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [Furniture] [Metal Furniture] [2017-10-16 14:07:55 ]
